MED16 Antibody - C-terminal region : HRP

MED16 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57927_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MED16

Key Reference: Sato,S., (2004) Mol. Cell 14 (5), 685-691

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mediator of RNA polymerase II transcription subunit 16

Protein Size: 877

Purification: Affinity Purified

Subunit: 16
Mehr Informationen
Artikelnummer AVIARP57927_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57927_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10025
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×