MED19 Antibody - middle region : HRP

MED19 Antibody - middle region : HRP
Artikelnummer
AVIARP55596_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II .

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MED19

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mediator of RNA polymerase II transcription subunit 19

Protein Size: 244

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55596_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55596_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 219541
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×