MED31 Antibody - N-terminal region : Biotin

MED31 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56820_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MED31

Key Reference: Cavdar (er) World J Surg (2008) In press

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 31

Protein Size: 131

Purification: Affinity Purified

Subunit: 31
Mehr Informationen
Artikelnummer AVIARP56820_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56820_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 51003
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×