MEIOB Antibody - C-terminal region : Biotin

MEIOB Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP55533_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MEIOB

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: ANILLNFIRENKETNVLDDEIDSYFKESINLSTIVDVYTVEQLKGKALKN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Meiosis-specific with OB domain-containing protein Ensembl ENSP00000390778 Ensembl ENSP00000314484

Protein Size: 471

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55533_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55533_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 254528
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×