MEIOC Antibody - C-terminal region : Biotin

MEIOC Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54485_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ35848

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: meiosis-specific coiled-coil domain-containing protein MEIOC

Protein Size: 622

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54485_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54485_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284071
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×