Melittin (C-Term Cysteine labeled) (trifluoroacetate salt)

Melittin (C-Term Cysteine labeled) (trifluoroacetate salt)
Artikelnummer
CAY37504
Verpackungseinheit
1 mg
Hersteller
Cayman Chemical

Verfügbarkeit: wird geladen...
Preis wird geladen...
Shelf life (days): 1460.0

Formulation: A solid

Formal Name: glycyl-L-isoleucylglycyl-L-alanyl-L-valyl-L-leucyl-L-lysyl-L-valyl-L-leucyl-L-threonyl-L-threonylglycyl-L-leucyl-L-prolyl-L-alanyl-L-leucyl-L-isoleucyl-L-seryl-L-tryptophyl-L-isoleucyl-L-lysyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminyl-L-glutaminyl-L-cysteinamide, trifluoroacetate salt

Amino Acids: GIGAVLKVLTTGLPALISWIKRKRQQC-NH2

Purity: ≥95%

Formula Markup: C134H234N40O32S / XCF3COOH

Formula Weight: 2949.60816

Notes: Melittin (C-term cysteine labeled) is a derivative of the cytotoxic bee venom peptide melittin (Item No. 17494) with a cysteine residue at the C-terminus.{51356,51357} It induces hemolysis of isolated human red blood cells at endosomal and extracellular pHs (EC50s = 5 and 6 µM at pH 5.5 and 7.4, respectively).{51356} Melittin (C-term cysteine labeled) has been used in the synthesis of membrane-lytic polymers that have been used in the generation of polyplexes for plasmid delivery in vitro and in vivo.{51357}
Mehr Informationen
Artikelnummer CAY37504
Hersteller Cayman Chemical
Hersteller Artikelnummer 37504-1
Verpackungseinheit 1 mg
Mengeneinheit STK
Methode Reinstoffe
Produktinformation (PDF) Download
MSDS (PDF) Download