Memo1 Antibody - C-terminal region : Biotin

Memo1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56787_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Memo1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Memo1 is a mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization.

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: KLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein MEMO1

Protein Size: 297

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56787_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56787_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 298787
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×