MEMO1 Antibody - middle region : FITC

MEMO1 Antibody - middle region : FITC
Artikelnummer
AVIARP56786_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MEMO1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein MEMO1

Protein Size: 297

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56786_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56786_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51072
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×