PrEST Antigen MACC1

metastasis associated in colon cancer 1
Artikelnummer
ATLAPREST75106-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: DSSGDELDVHQLLRQTSSRNSGRSKSVSELLDILDDTAHAHQSIHNSDQILLHDLEWLKNDREAYKMAWLSQRQLARSCLDLNTISQ

GeneName: MACC1

Ensembl Gene ID: ENSG00000183742

UniProt ID: Q6ZN28

Entrez Gene ID: 346389

Buffer: PBS and 1M Urea, pH 7.4.

Concentration: 6.0

Interspecies Mouse/Rat: ENSRNOG00000037436: 80%, ENSMUSG00000041886: 79%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST75106-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APREST75106-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 346389
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download