METTL4 antibody

METTL4 antibody
Artikelnummer
GTX04574-100
Verpackungseinheit
100 μl
Hersteller
GeneTex

Verfügbarkeit: wird geladen...
Preis wird geladen...
Calculated MW: 54

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% Sodium Azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: Enables RNA methyltransferase activity and site-specific DNA-methyltransferase (adenine-specific) activity. Involved in nucleic acid metabolic process; regulation of RNA metabolic process; and regulation of mitochondrial DNA replication. Located in cytosol; mitochondrial matrix; and nucleus. [provided by Alliance of Genome Resources, Apr 2022]

Uniprot ID: Q8N3J2

Antigen Species: Human

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Mettl4: SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS .

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: methyltransferase like 4
Mehr Informationen
Artikelnummer GTX04574-100
Hersteller GeneTex
Hersteller Artikelnummer GTX04574-100
Verpackungseinheit 100 μl
Mengeneinheit STK
Reaktivität Rat (Rattus)
Klonalität Polyclonal
Methode Western Blotting
Isotyp IgG
Human Gene ID 64863
Wirt Rabbit
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF)
×