METTL5 Antibody - N-terminal region : Biotin

METTL5 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54981_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: METTL5 is a probable methyltransferase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human METTL5

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methyltransferase-like protein 5

Protein Size: 209

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54981_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54981_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29081
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×