MFAP1 Antibody - middle region : FITC

MFAP1 Antibody - middle region : FITC
Artikelnummer
AVIARP56655_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MFAP1 is a component of the elastin-associated microfibrils.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MFAP1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Microfibrillar-associated protein 1

Protein Size: 439

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56655_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56655_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4236
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×