MFAP1 Antibody - middle region : HRP

MFAP1 Antibody - middle region : HRP
Artikelnummer
AVIARP56655_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MFAP1 is a component of the elastin-associated microfibrils.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MFAP1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Microfibrillar-associated protein 1

Protein Size: 439

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56655_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56655_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4236
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×