MFAP2 Antibody - N-terminal region : HRP

MFAP2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56961_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MFAP2

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Microfibrillar-associated protein 2

Protein Size: 183

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56961_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56961_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4237
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×