MFN1 Antibody - middle region : Biotin

MFN1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57702_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MFN1

Molecular Weight: 84

Peptide Sequence: Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitofusin-1

Protein Size: 741

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57702_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57702_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55669
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×