MGC33407 Antibody - middle region : HRP

MGC33407 Antibody - middle region : HRP
Artikelnummer
AVIARP55773_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGC33407

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: DHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYVASQSVLSVYAHGRVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Actin-like protein 9

Protein Size: 416

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55773_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55773_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284382
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×