MGC34821 Antibody - middle region : FITC

MGC34821 Antibody - middle region : FITC
Artikelnummer
AVIARP56052_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGC34821

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Solute carrier family 22 member 24 Ensembl ENSP00000396586

Protein Size: 551

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56052_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56052_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283238
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×