MGC51025 Antibody - C-terminal region : HRP

MGC51025 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55784_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MGC51025 may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MGC51025

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: LLCLPEEDAFWALTQLLAGERHSLWYSTAQILPGSRGSYRTRSRCCTSPS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TBC1 domain family member 26

Protein Size: 250

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55784_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55784_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 353149
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×