MGC51025 Antibody - middle region : FITC

MGC51025 Antibody - middle region : FITC
Artikelnummer
AVIARP55785_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MGC51025 may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGC51025

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 26

Protein Size: 250

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55785_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55785_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 353149
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×