MGC87631 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGC87631

Molecular Weight: 24

Peptide Sequence: Synthetic peptide located within the following region: VDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative coiled-coil domain-containing protein 144 N-terminal-like

Protein Size: 221

Purification: Affinity Purified

• Artikelnummer: AVIARP54385_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54385_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 339184
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin