MIF Antibody - middle region : Biotin

MIF Antibody - middle region : Biotin
Artikelnummer
AVIARP56347_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MIF

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: PQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Macrophage migration inhibitory factor

Protein Size: 115

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56347_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56347_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 4282
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×