MINDY1 Antibody - middle region : FITC

MINDY1 Antibody - middle region : FITC
Artikelnummer
AVIARP56272_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM63A

Key Reference: Lehner,B. (2004) Genome Res. 14 (7), 1315-1323

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: LQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ubiquitin carboxyl-terminal hydrolase MINDY-1

Protein Size: 327

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56272_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56272_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55793
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×