MKLN1 Antibody - N-terminal region : FITC

MKLN1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56737_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MKLN1

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: ADFWAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Muskelin

Protein Size: 528

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56737_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56737_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4289
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×