MKLN1 Antibody - N-terminal region : HRP

MKLN1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56737_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MKLN1

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: ADFWAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Muskelin

Protein Size: 528

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56737_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56737_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4289
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×