MKNK2 Antibody - N-terminal region : FITC

MKNK2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55352_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MKNK2

Key Reference: Wang,P., (2006) Sci. China, C, Life Sci. 49 (3), 265-273

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAP kinase-interacting serine/threonine-protein kinase 2

Protein Size: 465

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55352_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55352_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 2872
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×