MMD2 Antibody - N-terminal region : Biotin

MMD2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54544_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the PAQR (progestin and adipoQ receptor) family. Members of this family are evolutionarily conserved with significant sequence identity to bacterial hemolysin-like proteins and are defined by a set of seven transmembrane domains. The protein encoded by this gene localizes to the Golgi apparatus to modulate Ras signaling. Alternative splicing results in multiple transcript variants and protein isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MMD2

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: APRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Monocyte to macrophage differentiation factor 2

Protein Size: 246

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54544_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54544_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221938
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×