MMD2 Antibody - N-terminal region : Biotin

MMD2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54545_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: MMD2 contains 1 COMM domain. The exact function of MMD2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MMD2

Key Reference: Tang,Y.T., (2005) J. Mol. Evol. 61 (3), 372-380

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Monocyte to macrophage differentiation factor 2

Protein Size: 270

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54545_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54545_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221938
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×