MMD2 Antibody - N-terminal region : HRP

MMD2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54544_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the PAQR (progestin and adipoQ receptor) family. Members of this family are evolutionarily conserved with significant sequence identity to bacterial hemolysin-like proteins and are defined by a set of seven transmembrane domains. The protein encoded by this gene localizes to the Golgi apparatus to modulate Ras signaling. Alternative splicing results in multiple transcript variants and protein isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MMD2

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: APRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Monocyte to macrophage differentiation factor 2

Protein Size: 246

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54544_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54544_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221938
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×