MMP13 Antibody - middle region : Biotin

MMP13 Antibody - middle region : Biotin
Artikelnummer
AVIARP56350_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MMP13

Key Reference: Borghese,B., (2008) Hum. Reprod. 23 (5), 1207-1213

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Collagenase 3

Protein Size: 471

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56350_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56350_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4322
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×