MMP26 Antibody - C-terminal region : FITC

MMP26 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57558_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MMP26

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: NLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Matrix metalloproteinase-26

Protein Size: 261

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57558_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57558_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56547
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×