MNS1 Antibody - middle region : Biotin

MNS1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57224_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein. The mouse protein was shown to be expressed at the pachytene stage during spermatogenesis and may function as a nuclear skeletal protein to regulate nuc

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MNS1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Meiosis-specific nuclear structural protein 1

Protein Size: 495

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57224_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57224_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55329
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×