MOAP1 Antibody - C-terminal region : HRP

MOAP1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57614_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene was identified by its interaction with apoptosis regulator BAX protein. This protein contains a Bcl-2 homology 3 (BH3)-like motif, which is required for the association with BAX. When overexpressed, this gene has been shown to mediate caspase-dependent apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MOAP1

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTIRRELNLP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 351

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57614_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57614_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64112
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×