Mpp2 Antibody - C-terminal region : Biotin

Mpp2 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56633_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Mpp2 is a protein related to CASK that may play a role in synaptic vesicle exocytosis and synaptic junctions.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Mpp2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: ADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2), isoform CRA_a EMBL EDM06167.1

Protein Size: 552

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56633_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56633_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 85275
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×