MPP2 Antibody - middle region : HRP

MPP2 Antibody - middle region : HRP
Artikelnummer
AVIARP56632_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Palmitoylated membrane protein 2 is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracel

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MPP2

Key Reference: Wierstra,I. (2006) Biol. Chem. 387 (7), 963-976

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MAGUK p55 subfamily member 2

Protein Size: 552

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56632_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56632_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4355
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×