MPP3 Antibody - N-terminal region : Biotin

MPP3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56334_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MPP3

Key Reference: Kantardzhieva,A., (2006) FEBS J. 273 (6), 1152-1165

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAGUK p55 subfamily member 3

Protein Size: 585

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56334_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56334_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4356
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×