Mprip Antibody - middle region : FITC

Mprip Antibody - middle region : FITC
Artikelnummer
AVIARP57861_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mouse homolog binds F-actin and may play a role in F-actin bundling and cytoskeleton organization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Mprip

Molecular Weight: 113kDa

Peptide Sequence: Synthetic peptide located within the following region: ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myosin phosphatase Rho-interacting protein

Protein Size: 1029

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57861_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57861_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 116504
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×