MPV17L Antibody - N-terminal region : FITC

MPV17L Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55695_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MPV17L

Key Reference: Iida,R., (2006) Biochem. Biophys. Res. Commun. 344 (3), 948-954

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mpv17-like protein

Protein Size: 196

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55695_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55695_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 255027
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×