MPV17L Antibody - N-terminal region : HRP

MPV17L Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55695_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MPV17L

Key Reference: Iida,R., (2006) Biochem. Biophys. Res. Commun. 344 (3), 948-954

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mpv17-like protein

Protein Size: 196

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55695_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55695_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 255027
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×