MRPL47 Antibody - middle region : HRP

MRPL47 Antibody - middle region : HRP
Artikelnummer
AVIARP57768_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MRPL47

Key Reference: Zhang,Z. (2003) Genomics 81 (5), 468-480

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 39S ribosomal protein L47, mitochondrial

Protein Size: 140

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57768_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57768_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57129
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×