Mrpl48 Antibody - C-terminal region : FITC

Mrpl48 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56817_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Mrpl48

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: ISGLSATFAEIFLEILQINLPEGVRLSVREHTEEDFKGRFKARPELEELL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial ribosomal protein L48 (Predicted), isoform CRA_c EMBL EDM18332.1

Protein Size: 211

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56817_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56817_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 293149
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×