Msn Antibody - C-terminal region : HRP

Msn Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56189_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Msn is probably involved in connections of major cytoskeletal structures to the plasma membrane.

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: SELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFES

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Moesin

Protein Size: 577

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56189_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56189_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 17698
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×