MSRA Antibody - middle region : HRP

MSRA Antibody - middle region : HRP
Artikelnummer
AVIARP56732_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MSRA

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitochondrial peptide methionine sulfoxide reductase

Protein Size: 235

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56732_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56732_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 4482
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×