MTBP Antibody - middle region : HRP

MTBP Antibody - middle region : HRP
Artikelnummer
AVIARP55384_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein that interacts with the oncoprotein mouse double minute 2. The encoded protein regulates progression through the cell cycle and may be involved in tumor formation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTBP

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: SLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: mdm2-binding protein

Protein Size: 329

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55384_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55384_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27085
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×