MTIF3 Antibody - middle region : Biotin

MTIF3 Antibody - middle region : Biotin
Artikelnummer
AVIARP55563_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTIF3

Key Reference: Abahuni,N., (2007) Neurosci. Lett. 414 (2), 126-129

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Translation initiation factor IF-3, mitochondrial

Protein Size: 278

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55563_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55563_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 219402
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×