MTMR12 Antibody - middle region : HRP

MTMR12 Antibody - middle region : HRP
Artikelnummer
AVIARP56273_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTMR12

Key Reference: Nandurkar,H.H., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (15), 8660-8665

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: PLYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Myotubularin-related protein 12

Protein Size: 747

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56273_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56273_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54545
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×