MTO1 Antibody - N-terminal region : FITC

MTO1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54841_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MTO1 is a mitochondrial protein thought to be involved in mitochondrial tRNA modification. It may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene.This gene encodes a mitochondrial protein thought to be involved in mitochondrial tRNA modification. The encoded protein may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTO1

Key Reference: Krull,M., (2005) Mol. Biol. Evol. 22 (8), 1702-1711

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein MTO1 homolog, mitochondrial

Protein Size: 732

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54841_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54841_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25821
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×