MTRF1L Antibody - N-terminal region : HRP

MTRF1L Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56320_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MTRF1L is a mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTRF1L

Key Reference: Nozaki,Y., (2008) Genes Cells 13 (5), 429-438

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peptide chain release factor 1-like, mitochondrial

Protein Size: 271

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56320_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56320_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54516
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×