MUCL3 Antibody

Uniprot: Q3MIW9

Gene Name: MUCL3

Immunogen: Recombinant human MUCL3

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 46%

Core Sequence: TFQEYQKTGELSTSDHIFPLTPGLVYSIPFDHIVLHSGQRPPELPKSTEIHEQKRHCNTTRHSKPTDKPTGNSKTIDHKSSTDNHEAPPTSEENSSNQGKDPMIRNQRSVDPADSTTTHKESAGKKHITPAPKSKINCRK

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 46%, Rat - 52%, Pig - 48%, Cynomolgus monkey - 86%

Alternative gene names: C6orf37；DPCR1；PBLT

Alternative protein names: Mucin-like protein 3; Diffuse panbronchiolitis critical region protein 1

Protein name: Mucin like 3

Clone No.: K29096_6G11

Antigen Species: Human

Target Name: MUCL3

IHC Verification: succeed

IHC Dilution: 1:100~1:200

WB Verification: Fail (A-375,Hep G2,NCI-N87)

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-869

Cross reactivity: Not tested

• Artikelnummer: ASBKC-3997-50
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-3997-50
• Verpackungseinheit: 50 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunohistochemistry, Immunocytochemistry
• Isotyp: IgG2a
• Human Gene ID: 135656
• Wirt: Mouse
• Konjugat: Unconjugated