MUCL3 Antibody

MUCL3 Antibody
Artikelnummer
ASBKC-3997-50
Verpackungseinheit
50 μl
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Uniprot: Q3MIW9

Gene Name: MUCL3

Immunogen: Recombinant human MUCL3

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 46%

Core Sequence: TFQEYQKTGELSTSDHIFPLTPGLVYSIPFDHIVLHSGQRPPELPKSTEIHEQKRHCNTTRHSKPTDKPTGNSKTIDHKSSTDNHEAPPTSEENSSNQGKDPMIRNQRSVDPADSTTTHKESAGKKHITPAPKSKINCRK

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 46%, Rat - 52%, Pig - 48%, Cynomolgus monkey - 86%

Alternative gene names: C6orf37;DPCR1;PBLT

Alternative protein names: Mucin-like protein 3; Diffuse panbronchiolitis critical region protein 1

Protein name: Mucin like 3

Clone No.: K29096_6G11

Antigen Species: Human

Target Name: MUCL3

IHC Verification: succeed

IHC Dilution: 1:100~1:200

WB Verification: Fail (A-375,Hep G2,NCI-N87)

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-869

Cross reactivity: Not tested
Mehr Informationen
Artikelnummer ASBKC-3997-50
Hersteller Absea Biotechnology
Hersteller Artikelnummer KC-3997-50
Verpackungseinheit 50 μl
Mengeneinheit STK
Reaktivität Human
Klonalität Monoclonal
Methode Immunohistochemistry, Immunocytochemistry
Isotyp IgG2a
Human Gene ID 135656
Wirt Mouse
Konjugat Unconjugated
Produktinformation (PDF)
×
MSDS (PDF)
×