Mut Antibody - N-terminal region : Biotin

Mut Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56080_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Mut is involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mut

Molecular Weight: 82kDa

Peptide Sequence: Synthetic peptide located within the following region: LAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methylmalonyl-CoA mutase, mitochondrial

Protein Size: 748

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56080_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56080_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 17850
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×