Mut Antibody - N-terminal region : HRP

Mut Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56080_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mut is involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mut

Molecular Weight: 82kDa

Peptide Sequence: Synthetic peptide located within the following region: LAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Methylmalonyl-CoA mutase, mitochondrial

Protein Size: 748

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56080_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56080_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 17850
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×